Detailed Results for 16853

NCBI BLAST search of 16853.00116675 against nr

Pseudomonas syringae TOF-TOF Example

Mascot Search Results: Protein Summary Report View

Match 16853.00116675
Score 1030
Description 4887162..4888607
Nominal mass (Mr) 51882
Calculated pI value 6.35
Variable modifications Carbamidomethyl (C),Oxidation (M),Propionamide (C)
Cleavage by Trypsin cuts C-term side of KR unless next residue is P
Sequence Coverage 82%

Protein Amino Acid Sequence

1 TVRRTKIVAT LGPASNSPEV IEQLILSGLD VARLNFSHGT PDEHKARAKL
51 IREIAARHGR FVALLGDLQG PKIRIAKFTD KRIELKVGDK FTFSTAHPLT
101 SGNQQIVGID YPDLVKDCGV GDELLLDDGR VVMRVDTQTA HELHCTVLIG
151 GPLSDHKGIN RRGGGLTAPA LTEKDKQDIK LAAEMDLDYL AVSFPRDAAD
201 MEYARQLRDE SGGTAWLVAK IERAEAVAND EVLDALIRAS DAVMVARGDL
251 GVEIGDAELV GVQKRIILHA RRHNKAVIVA TQMMESMISS PMPTRAEVSD
301 VANAVLDYTD AVMLSAESAA GSYPVEAVQA MARICVGAEK HPTGKTSSHR
351 IGHSFTRCDE SIALAAMYTA NHFPGVKAII ALTESGYTPL IMSRIRSSVP
401 IYAFSPHRGT QARAAMFRGV YTVPFDPGAL PPGQVSQAAV DELLKRGLVE
451 QGDWVILTKG DSYHTIGGTN GMKILHVGDP LV



Start - End Observed Mr(expt) Mr(calc) Delta Miss Ions Sequence
7 - 33 2762.52 2761.51 2761.52 -0.01 0 136 IVATLGPASNSPEVIEQLILSGLDVAR
7 - 33 2762.52 2761.51 2761.52 -0.01 0 - IVATLGPASNSPEVIEQLILSGLDVAR
34 - 45 1381.66 1380.66 1380.64 0.01 0 - LNFSHGTPDEHK
50 - 57 941.62 940.62 940.58 0.03 1 - LIREIAAR
61 - 72 1257.73 1256.72 1256.71 0.01 0 96 FVALLGDLQGPK
61 - 72 1257.73 1256.72 1256.71 0.01 0 - FVALLGDLQGPK
91 - 116 2848.46 2847.45 2847.44 0.00 0 71 FTFSTAHPLTSGNQQIVGIDYPDLVK
91 - 116 2848.46 2847.45 2847.44 0.00 0 - FTFSTAHPLTSGNQQIVGIDYPDLVK
117 - 130 1533.70 1532.69 1532.68 0.02 0 - DCGVGDELLLDDGR Carbamidomethyl (C)
135 - 157 2528.26 2527.25 2527.25 0.00 0 45 VDTQTAHELHCTVLIGGPLSDHK Carbamidomethyl (C)
135 - 157 2528.26 2527.25 2527.25 0.00 0 - VDTQTAHELHCTVLIGGPLSDHK Carbamidomethyl (C)
163 - 174 1114.62 1113.61 1113.60 0.01 0 - GGGLTAPALTEK
181 - 196 1826.91 1825.90 1825.89 0.01 0 79 LAAEMDLDYLAVSFPR Oxidation (M)
181 - 196 1826.91 1825.90 1825.89 0.01 0 - LAAEMDLDYLAVSFPR Oxidation (M)
197 - 205 1057.43 1056.42 1056.42 0.01 0 - DAADMEYAR
197 - 205 1057.43 1056.42 1056.42 0.01 0 5 DAADMEYAR Oxidation (M)
221 - 238 1997.08 1996.07 1996.06 0.01 1 - IERAEAVANDEVLDALIR
221 - 238 1997.08 1996.07 1996.06 0.01 1 10 IERAEAVANDEVLDALIR
224 - 238 1598.85 1597.84 1597.83 0.01 0 36 AEAVANDEVLDALIR
224 - 238 1598.85 1597.84 1597.83 0.01 0 - AEAVANDEVLDALIR
239 - 247 935.48 934.47 934.45 0.01 0 - ASDAVMVAR Oxidation (M)
248 - 264 1698.91 1697.90 1697.88 0.02 0 35 GDLGVEIGDAELVGVQK
248 - 264 1698.91 1697.90 1697.88 0.02 0 - GDLGVEIGDAELVGVQK
248 - 265 1855.00 1853.99 1853.98 0.01 1 - GDLGVEIGDAELVGVQKR
266 - 272 878.58 877.57 877.56 0.01 1 - IILHARR
276 - 295 2228.05 2227.04 2227.04 0.00 0 - AVIVATQMMESMISSPMPTR 3 Oxidation (M)
276 - 295 2244.04 2243.03 2243.03 0.00 0 - AVIVATQMMESMISSPMPTR 4 Oxidation (M)
296 - 333 3903.91 3902.90 3902.82 0.08 0 - AEVSDVANAVLDYTDAVMLSAESAAGSYPVEAVQAMAR 2 Oxidation (M)
334 - 345 1296.69 1295.68 1295.67 0.01 1 - ICVGAEKHPTGK Carbamidomethyl (C)
358 - 377 2195.05 2194.04 2194.02 0.02 0 - CDESIALAAMYTANHFPGVK Carbamidomethyl (C)
378 - 394 1835.98 1834.98 1834.99 -0.01 0 - AIIALTESGYTPLIMSR
378 - 394 1852.00 1850.99 1850.98 0.01 0 - AIIALTESGYTPLIMSR Oxidation (M)
378 - 394 1852.00 1850.99 1850.98 0.01 0 18 AIIALTESGYTPLIMSR Oxidation (M)
395 - 408 1629.90 1628.89 1628.88 0.02 1 - IRSSVPIYAFSPHR
395 - 408 1629.90 1628.89 1628.88 0.02 1 16 IRSSVPIYAFSPHR
397 - 408 1360.72 1359.71 1359.69 0.02 0 59 SSVPIYAFSPHR
397 - 408 1360.72 1359.71 1359.69 0.02 0 - SSVPIYAFSPHR
419 - 445 2768.45 2767.44 2767.44 -0.00 0 - GVYTVPFDPGALPPGQVSQAAVDELLK
419 - 446 2924.53 2923.52 2923.54 -0.02 1 53 GVYTVPFDPGALPPGQVSQAAVDELLKR
419 - 446 2924.53 2923.52 2923.54 -0.02 1 53 GVYTVPFDPGALPPGQVSQAAVDELLKR
419 - 446 2924.53 2923.52 2923.54 -0.02 1 108 GVYTVPFDPGALPPGQVSQAAVDELLKR
446 - 459 1613.92 1612.91 1612.89 0.02 1 - RGLVEQGDWVILTK
447 - 459 1457.81 1456.81 1456.79 0.01 0 - GLVEQGDWVILTK
460 - 473 1453.66 1452.65 1452.63 0.02 0 - GDSYHTIGGTNGMK Oxidation (M)
474 - 482 962.58 961.57 961.56 0.01 0 - ILHVGDPLV
474 - 482 962.58 961.57 961.56 0.01 0 42 ILHVGDPLV

Return to MASCOT search