You are here

MASCOT Search Results

Mascot Search Results


Pseudomonas syringae TOF-TOF Example

Search title: SampleSetID: 2022, AnalysisID: 4593, MaldiWellID: 58508, SpectrumID: 69836, Path=\LC PS 2003\ps 2003-10-02\c B16 1\1\B16
Database: Syringae6frame new (1836856 sequences; 298367028 residues)
Taxonomy: Bacteria (Eubacteria) (1836856 sequences)
Timestamp: 3 Oct 2003 at 17:57:19 GMT
Top Score: 1030 for 16853.00116675, 4887162..4888607

Probability Based Mowse Score

Score is -10*Log(P), where P is the probability that the observed match is a random event.
Protein scores greater than 75 are significant (p<0.05).

Protein Summary Report

Switch to Peptide Summary Report

Index of Top 5 Hits

Click on accession number to navigate immediately to the specific hit.

Accession Mass Score Description (genome sequence location)
1. 16853.00116675 51882 1030 4887162..4888607
2. 16853.00116675M 52013 1030 4887159..4888607
3. 16853.00116674 52116 1030 4887156..4888607
4. 16853.00116674M 52247 1030 4887153..4888607
5. 16853.00116680 48838 884 4887249..4888607

Results List

Click the top hit's accession number to see the corresponding results.

Accession Mass Score Description (genome sequence location)
1. 16853.00116675 51882 1030 4887162..4888607
Observed Mr(expt) Mr(calc) Delta Start End Miss Ions Peptide
878.58 877.57 877.56 0.01 266 272 1 ---- IILHARR
935.48 934.47 934.45 0.01 239 247 0 ---- ASDAVMVAR Oxidation (M)
941.62 940.62 940.58 0.03 50 57 1 ---- LIREIAAR
962.58 961.57 961.56 0.01 474 482 0 ---- ILHVGDPLV
962.58 961.57 961.56 0.01 474 482 0 42 ILHVGDPLV
1057.43 1056.42 1056.42 0.01 197 205 0 ---- DAADMEYAR Oxidation (M)
1057.43 1056.42 1056.42 0.01 197 205 0 5 DAADMEYAR Oxidation (M)
1114.62 1113.61 1113.60 0.01 163 174 0 ---- GGGLTAPALTEK
1257.73 1256.72 1256.71 0.01 61 72 0 ---- FVALLGDLQGPK
1257.73 1256.72 1256.71 0.01 61 72 0 96 FVALLGDLQGPK
1296.69 1295.68 1295.67 0.01 334 345 1 ---- ICVGAEKHPTGK Carbamidomethyl (C)
1360.72 1359.71 1359.69 0.02 397 408 0 ---- SSVPIYAFSPHR
1360.72 1359.71 1359.69 0.02 397 408 0 59 SSVPIYAFSPHR
1381.66 1380.66 1380.64 0.01 34 45 0 ---- LNFSHGTPDEHK
1453.66 1452.65 1452.63 0.02 460 473 0 ---- GDSYHTIGGTNGMK Oxidation (M)
1457.81 1456.81 1456.79 0.01 447 459 0 ---- GLVEQGDWVILTK
1533.70 1532.69 1532.68 0.02 117 130 0 ---- DCGVGDELLLDDGR Carbamidomethyl (C)
1598.85 1597.84 1597.83 0.01 224 238 0 ---- AEAVANDEVLDALIR
1598.85 1597.84 1597.83 0.01 224 238 0 36 AEAVANDEVLDALIR
1613.92 1612.91 - 1612.89 0.02 446 459 1 ---- RGLVEQGDWVILTK
1629.90 1628.89 1628.88 0.02 395 408 1 ---- IRSSVPIYAFSPHR
1629.90 1628.89 1628.88 0.02 395 408 1 16 IRSSVPIYAFSPHR
1698.91 1697.90 1697.88 0.02 248 264 0 ---- GDLGVEIGDAELVGVQK
1698.91 1697.90 1697.88 0.02 248 264 0 35 GDLGVEIGDAELVGVQK
1826.91 1825.90 1825.89 0.01 181 196 0 ---- LAAEMDLDYLAVSFPR Oxidation (M)
1826.91 1825.90 1825.89 0.01 181 196 0 79 LAAEMDLDYLAVSFPR Oxidation (M)
1835.98 1834.98 1834.99 -0.01 378 394 0 ---- AIIALTESGYTPLIMSR
1852.00 1850.99 1850.98 0.01 378 394 0 ---- AIIALTESGYTPLIMSR Oxidation (M)
1852.00 1850.99 1850.98 0.01 378 394 0 18 AIIALTESGYTPLIMSR Oxidation (M)
1855.00 1853.99 1853.98 0.01 248 265 1 ---- GDLGVEIGDAELVGVQKR
1997.08 1996.07 1996.06 0.01 221 238 1 ---- IERAEAVANDEVLDALIR
1997.08 1996.07 1996.06 0.01 221 238 1 10 IERAEAVANDEVLDALIR
2195.05 2194.04 2194.02 0.02 358 377 0 ---- CDESIALAAMYTANHFPGVK Carbamidomethyl (C)
2228.05 2227.04 2227.04 0.00 276 295 0 ---- AVIVATQMMESMISSPMPTR 3 Oxidation (M)
2244.04 2243.03 2243.03 0.00 276 295 0 ---- AVIVATQMMESMISSPMPTR 4 Oxidation (M)
2528.26 2527.25 2527.25 0.00 135 157 0 ---- VDTQTAHELHCTVLIGGPLSDHK Carbamidomethyl (C)
2528.26 2527.25 2527.25 0.00 135 157 0 45 VDTQTAHELHCTVLIGGPLSDHK Carbamidomethyl (C)
2762.52 2761.51 2761.52 -0.01 7 33 0 ---- IVATLGPASNSPEVIEQLILSGLDVAR
2762.52 2761.51 2761.52 -0.01 7 33 0 136 IVATLGPASNSPEVIEQLILSGLDVAR
2768.45 2767.44 2767.44 -0.00 419 445 0 ---- GVYTVPFDPGALPPGQVSQAAVDELLK
2848.46 2847.45 2847.44 0.00 91 116 0 ---- FTFSTAHPLTSGNQQIVGIDYPDLVK
2848.46 2847.45 2847.44 0.00 91 116 0 71 FTFSTAHPLTSGNQQIVGIDYPDLVK
2924.53 2923.52 2923.54 -0.02 419 446 1 53 GVYTVPFDPGALPPGQVSQAAVDELLKR
2924.53 2923.52 2923.54 -0.02 419 446 1 53 GVYTVPFDPGALPPGQVSQAAVDELLKR
2924.53 2923.52 2923.54 -0.02 419 446 1 108 GVYTVPFDPGALPPGQVSQAAVDELLKR
3903.91 3902.90 3902.82 0.08 296 333 0 ---- AEVSDVANAVLDYTDAVMLSAESAAGSYPVEAVQAMAR 2 Oxidation (M)

No match to: 856.23, 856.53, 859.22, 862.62, 870.55, 882.27, 970.58, 995.63, 1358.70, 1382.67, 1411.86, 1418.73, 1424.74, 1425.25, 1462.78, 1463.28, 1473.78, 1489.80, 1505.78, 1647.86, 1765.04, 1809.97, 1825.90, 1841.96, 1842.92, 1867.99, 2210.04, 2241.09, 2779.97, 2788.43, 2992.66, 3842.99, 3907.81, 3919.83



Accession Mass Score Description (genome sequence location)
2. 16853.00116675M 52013 1030 4887159..4888607
Observed Mr(expt) Mr(calc) Delta Start End Miss Ions Peptide
878.58 877.57 877.56 0.01 267 273 1 ---- IILHARR
935.48 934.47 934.45 0.01 240 248 0 ---- ASDAVMVAR Oxidation (M)
941.62 940.62 940.58 0.03 51 58 1 ---- LIREIAAR
962.58 961.57 961.56 0.01 475 483 0 ---- ILHVGDPLV
962.58 961.57 961.56 0.01 475 483 0 42 ILHVGDPLV
1057.43 1056.42 1056.42 0.01 198 206 0 ---- DAADMEYAR Oxidation (M)
1057.43 1056.42 1056.42 0.01 198 206 0 5 DAADMEYAR Oxidation (M)
1114.62 1113.61 1113.60 0.01 164 175 0 ---- GGGLTAPALTEK
1257.73 1256.72 1256.71 0.01 62 73 0 ---- FVALLGDLQGPK
1257.73 1256.72 1256.71 0.01 62 73 0 96 FVALLGDLQGPK
1296.69 1295.68 1295.67 0.01 335 346 1 ---- ICVGAEKHPTGK Carbamidomethyl (C)
1360.72 1359.71 1359.69 0.02 398 409 0 ---- SSVPIYAFSPHR
1360.72 1359.71 1359.69 0.02 398 409 0 59 SSVPIYAFSPHR
1381.66 1380.66 1380.64 0.01 35 46 0 ---- LNFSHGTPDEHK
1453.66 1452.65 1452.63 0.02 461 474 0 ---- GDSYHTIGGTNGMK Oxidation (M)
1457.81 1456.81 1456.79 0.01 448 460 0 ---- GLVEQGDWVILTK
1533.70 1532.69 1532.68 0.02 118 131 0 ---- DCGVGDELLLDDGR Carbamidomethyl (C)
1598.85 1597.84 1597.83 0.01 225 239 0 ---- AEAVANDEVLDALIR
1598.85 1597.84 1597.83 0.01 225 239 0 36 AEAVANDEVLDALIR
1613.92 1612.91 - 1612.89 0.02 447 460 1 ---- RGLVEQGDWVILTK
1629.90 1628.89 1628.88 0.02 396 409 1 ---- IRSSVPIYAFSPHR
1629.90 1628.89 1628.88 0.02 396 409 1 16 IRSSVPIYAFSPHR
1698.91 1697.90 1697.88 0.02 249 265 0 ---- GDLGVEIGDAELVGVQK
1698.91 1697.90 1697.88 0.02 249 265 0 35 GDLGVEIGDAELVGVQK
1826.91 1825.90 1825.89 0.01 182 197 0 ---- LAAEMDLDYLAVSFPR Oxidation (M)
1826.91 1825.90 1825.89 0.01 182 197 0 79 LAAEMDLDYLAVSFPR Oxidation (M)
1835.98 1834.98 1834.99 -0.01 379 395 0 ---- AIIALTESGYTPLIMSR
1852.00 1850.99 1850.98 0.01 379 395 0 ---- AIIALTESGYTPLIMSR Oxidation (M)
1852.00 1850.99 1850.98 0.01 379 395 0 18 AIIALTESGYTPLIMSR Oxidation (M)
1855.00 1853.99 1853.98 0.01 249 266 1 ---- GDLGVEIGDAELVGVQKR
1997.08 1996.07 1996.06 0.01 222 239 1 ---- IERAEAVANDEVLDALIR
1997.08 1996.07 1996.06 0.01 222 239 1 10 IERAEAVANDEVLDALIR
2195.05 2194.04 2194.02 0.02 359 378 0 ---- CDESIALAAMYTANHFPGVK Carbamidomethyl (C)
2228.05 2227.04 2227.04 0.00 277 296 0 ---- AVIVATQMMESMISSPMPTR 3 Oxidation (M)
2244.04 2243.03 2243.03 0.00 277 296 0 ---- AVIVATQMMESMISSPMPTR 4 Oxidation (M)
2528.26 2527.25 2527.25 0.00 136 158 0 ---- VDTQTAHELHCTVLIGGPLSDHK Carbamidomethyl (C)
2528.26 2527.25 2527.25 0.00 136 158 0 45 VDTQTAHELHCTVLIGGPLSDHK Carbamidomethyl (C)
2762.52 2761.51 2761.52 -0.01 8 34 0 ---- IVATLGPASNSPEVIEQLILSGLDVAR
2762.52 2761.51 2761.52 -0.01 8 34 0 136 IVATLGPASNSPEVIEQLILSGLDVAR
2768.45 2767.44 2767.44 -0.00 420 446 0 ---- GVYTVPFDPGALPPGQVSQAAVDELLK
2848.46 2847.45 2847.44 0.00 92 117 0 ---- FTFSTAHPLTSGNQQIVGIDYPDLVK
2848.46 2847.45 2847.44 0.00 92 117 0 71 FTFSTAHPLTSGNQQIVGIDYPDLVK
2924.53 2923.52 2923.54 -0.02 420 447 1 53 GVYTVPFDPGALPPGQVSQAAVDELLKR
2924.53 2923.52 2923.54 -0.02 420 447 1 53 GVYTVPFDPGALPPGQVSQAAVDELLKR
2924.53 2923.52 2923.54 -0.02 420 447 1 108 GVYTVPFDPGALPPGQVSQAAVDELLKR
3903.91 3902.90 3902.82 0.08 297 334 0 ---- AEVSDVANAVLDYTDAVMLSAESAAGSYPVEAVQAMAR 2 Oxidation (M)

No match to: 856.23, 856.53, 859.22, 862.62, 870.55, 882.27, 970.58, 995.63, 1358.70, 1382.67, 1411.86, 1418.73, 1424.74, 1425.25, 1462.78, 1463.28, 1473.78, 1489.80, 1505.78, 1647.86, 1765.04, 1809.97, 1825.90, 1841.96, 1842.92, 1867.99, 2210.04, 2241.09, 2779.97, 2788.43, 2992.66, 3842.99, 3907.81, 3919.83



Accession Mass Score Description (genome sequence location)
3. 16853.00116674 52116 1030 4887156..4888607
Observed Mr(expt) Mr(calc) Delta Start End Miss Ions Peptide
878.58 877.57 877.56 0.01 268 274 1 ---- IILHARR
935.48 934.47 934.45 0.01 241 249 0 ---- ASDAVMVAR Oxidation (M)
941.62 940.62 940.58 0.03 52 59 1 ---- LIREIAAR
962.58 961.57 961.56 0.01 476 484 0 ---- ILHVGDPLV
962.58 961.57 961.56 0.01 476 484 0 42 ILHVGDPLV
1057.43 1056.42 1056.42 0.01 199 207 0 ---- DAADMEYAR Oxidation (M)
1057.43 1056.42 1056.42 0.01 199 207 0 5 DAADMEYAR Oxidation (M)
1114.62 1113.61 1113.60 0.01 165 176 0 ---- GGGLTAPALTEK
1257.73 1256.72 1256.71 0.01 63 74 0 ---- FVALLGDLQGPK
1257.73 1256.72 1256.71 0.01 63 74 0 96 FVALLGDLQGPK
1296.69 1295.68 1295.67 0.01 336 347 1 ---- ICVGAEKHPTGK Carbamidomethyl (C)
1360.72 1359.71 1359.69 0.02 399 410 0 ---- SSVPIYAFSPHR
1360.72 1359.71 1359.69 0.02 399 410 0 59 SSVPIYAFSPHR
1381.66 1380.66 1380.64 0.01 36 47 0 ---- LNFSHGTPDEHK
1453.66 1452.65 1452.63 0.02 462 475 0 ---- GDSYHTIGGTNGMK Oxidation (M)
1457.81 1456.81 1456.79 0.01 449 461 0 ---- GLVEQGDWVILTK
1533.70 1532.69 1532.68 0.02 119 132 0 ---- DCGVGDELLLDDGR Carbamidomethyl (C)
1598.85 1597.84 1597.83 0.01 226 240 0 ---- AEAVANDEVLDALIR
1598.85 1597.84 1597.83 0.01 226 240 0 36 AEAVANDEVLDALIR
1613.92 1612.91 - 1612.89 0.02 448 461 1 ---- RGLVEQGDWVILTK
1629.90 1628.89 1628.88 0.02 397 410 1 ---- IRSSVPIYAFSPHR
1629.90 1628.89 1628.88 0.02 397 410 1 16 IRSSVPIYAFSPHR
1698.91 1697.90 1697.88 0.02 250 266 0 ---- GDLGVEIGDAELVGVQK
1698.91 1697.90 1697.88 0.02 250 266 0 35 GDLGVEIGDAELVGVQK
1826.91 1825.90 1825.89 0.01 183 198 0 ---- LAAEMDLDYLAVSFPR Oxidation (M)
1826.91 1825.90 1825.89 0.01 183 198 0 79 LAAEMDLDYLAVSFPR Oxidation (M)
1835.98 1834.98 1834.99 -0.01 380 396 0 ---- AIIALTESGYTPLIMSR
1852.00 1850.99 1850.98 0.01 380 396 0 ---- AIIALTESGYTPLIMSR Oxidation (M)
1852.00 1850.99 1850.98 0.01 380 396 0 18 AIIALTESGYTPLIMSR Oxidation (M)
1855.00 1853.99 1853.98 0.01 250 267 1 ---- GDLGVEIGDAELVGVQKR
1997.08 1996.07 1996.06 0.01 223 240 1 ---- IERAEAVANDEVLDALIR
1997.08 1996.07 1996.06 0.01 223 240 1 10 IERAEAVANDEVLDALIR
2195.05 2194.04 2194.02 0.02 360 379 0 ---- CDESIALAAMYTANHFPGVK Carbamidomethyl (C)
2228.05 2227.04 2227.04 0.00 278 297 0 ---- AVIVATQMMESMISSPMPTR 3 Oxidation (M)
2244.04 2243.03 2243.03 0.00 278 297 0 ---- AVIVATQMMESMISSPMPTR 4 Oxidation (M)
2528.26 2527.25 2527.25 0.00 137 159 0 ---- VDTQTAHELHCTVLIGGPLSDHK Carbamidomethyl (C)
2528.26 2527.25 2527.25 0.00 137 159 0 45 VDTQTAHELHCTVLIGGPLSDHK Carbamidomethyl (C)
2762.52 2761.51 2761.52 -0.01 9 35 0 ---- IVATLGPASNSPEVIEQLILSGLDVAR
2762.52 2761.51 2761.52 -0.01 9 35 0 136 IVATLGPASNSPEVIEQLILSGLDVAR
2768.45 2767.44 2767.44 -0.00 421 447 0 ---- GVYTVPFDPGALPPGQVSQAAVDELLK
2848.46 2847.45 2847.44 0.00 93 118 0 ---- FTFSTAHPLTSGNQQIVGIDYPDLVK
2848.46 2847.45 2847.44 0.00 93 118 0 71 FTFSTAHPLTSGNQQIVGIDYPDLVK
2924.53 2923.52 2923.54 -0.02 421 448 1 53 GVYTVPFDPGALPPGQVSQAAVDELLKR
2924.53 2923.52 2923.54 -0.02 421 448 1 53 GVYTVPFDPGALPPGQVSQAAVDELLKR
2924.53 2923.52 2923.54 -0.02 421 448 1 108 GVYTVPFDPGALPPGQVSQAAVDELLKR
3903.91 3902.90 3902.82 0.08 298 335 0 ---- AEVSDVANAVLDYTDAVMLSAESAAGSYPVEAVQAMAR 2 Oxidation (M)

No match to: 856.23, 856.53, 859.22, 862.62, 870.55, 882.27, 970.58, 995.63, 1358.70, 1382.67, 1411.86, 1418.73, 1424.74, 1425.25, 1462.78, 1463.28, 1473.78, 1489.80, 1505.78, 1647.86, 1765.04, 1809.97, 1825.90, 1841.96, 1842.92, 1867.99, 2210.04, 2241.09, 2779.97, 2788.43, 2992.66, 3842.99, 3907.81, 3919.83


Accession Mass Score Description (genome sequence location)
4. 16853.00116674M 52247 1030 4887153..4888607
Observed Mr(expt) Mr(calc) Delta Start End Miss Ions Peptide
878.58 877.57 877.56 0.01 269 275 1 ---- IILHARR
935.48 934.47 934.45 0.01 242 250 0 ---- ASDAVMVAR Oxidation (M)
941.62 940.62 940.58 0.03 53 60 1 ---- LIREIAAR
962.58 961.57 961.56 0.01 477 485 0 ---- ILHVGDPLV
962.58 961.57 961.56 0.01 477 485 0 42 ILHVGDPLV
1057.43 1056.42 1056.42 0.01 200 208 0 ---- DAADMEYAR Oxidation (M)
1057.43 1056.42 1056.42 0.01 200 208 0 5 DAADMEYAR Oxidation (M)
1114.62 1113.61 1113.60 0.01 166 177 0 ---- GGGLTAPALTEK
1257.73 1256.72 1256.71 0.01 64 75 0 ---- FVALLGDLQGPK
1257.73 1256.72 1256.71 0.01 64 75 0 96 FVALLGDLQGPK
1296.69 1295.68 1295.67 0.01 337 348 1 ---- ICVGAEKHPTGK Carbamidomethyl (C)
1360.72 1359.71 1359.69 0.02 400 411 0 ---- SSVPIYAFSPHR
1360.72 1359.71 1359.69 0.02 400 411 0 59 SSVPIYAFSPHR
1381.66 1380.66 1380.64 0.01 37 48 0 ---- LNFSHGTPDEHK
1453.66 1452.65 1452.63 0.02 463 476 0 ---- GDSYHTIGGTNGMK Oxidation (M)
1457.81 1456.81 1456.79 0.01 450 462 0 ---- GLVEQGDWVILTK
1533.70 1532.69 1532.68 0.02 120 133 0 ---- DCGVGDELLLDDGR Carbamidomethyl (C)
1598.85 1597.84 1597.83 0.01 227 241 0 ---- AEAVANDEVLDALIR
1598.85 1597.84 1597.83 0.01 227 241 0 36 AEAVANDEVLDALIR
1613.92 1612.91 - 1612.89 0.02 449 462 1 ---- RGLVEQGDWVILTK
1629.90 1628.89 1628.88 0.02 398 411 1 ---- IRSSVPIYAFSPHR
1629.90 1628.89 1628.88 0.02 398 411 1 16 IRSSVPIYAFSPHR
1698.91 1697.90 1697.88 0.02 251 267 0 ---- GDLGVEIGDAELVGVQK
1698.91 1697.90 1697.88 0.02 251 267 0 35 GDLGVEIGDAELVGVQK
1826.91 1825.90 1825.89 0.01 184 199 0 ---- LAAEMDLDYLAVSFPR Oxidation (M)
1826.91 1825.90 1825.89 0.01 184 199 0 79 LAAEMDLDYLAVSFPR Oxidation (M)
1835.98 1834.98 1834.99 -0.01 381 397 0 ---- AIIALTESGYTPLIMSR
1852.00 1850.99 1850.98 0.01 381 397 0 ---- AIIALTESGYTPLIMSR Oxidation (M)
1852.00 1850.99 1850.98 0.01 381 397 0 18 AIIALTESGYTPLIMSR Oxidation (M)
1855.00 1853.99 1853.98 0.01 251 268 1 ---- GDLGVEIGDAELVGVQKR
1997.08 1996.07 1996.06 0.01 224 241 1 ---- IERAEAVANDEVLDALIR
1997.08 1996.07 1996.06 0.01 224 241 1 10 IERAEAVANDEVLDALIR
2195.05 2194.04 2194.02 0.02 361 380 0 ---- CDESIALAAMYTANHFPGVK Carbamidomethyl (C)
2228.05 2227.04 2227.04 0.00 279 298 0 ---- AVIVATQMMESMISSPMPTR 3 Oxidation (M)
2244.04 2243.03 2243.03 0.00 279 298 0 ---- AVIVATQMMESMISSPMPTR 4 Oxidation (M)
2528.26 2527.25 2527.25 0.00 138 160 0 ---- VDTQTAHELHCTVLIGGPLSDHK Carbamidomethyl (C)
2528.26 2527.25 2527.25 0.00 138 160 0 45 VDTQTAHELHCTVLIGGPLSDHK Carbamidomethyl (C)
2762.52 2761.51 2761.52 -0.01 10 36 0 ---- IVATLGPASNSPEVIEQLILSGLDVAR
2762.52 2761.51 2761.52 -0.01 10 36 0 136 IVATLGPASNSPEVIEQLILSGLDVAR
2768.45 2767.44 2767.44 -0.00 422 448 0 ---- GVYTVPFDPGALPPGQVSQAAVDELLK
2848.46 2847.45 2847.44 0.00 94 119 0 ---- FTFSTAHPLTSGNQQIVGIDYPDLVK
2848.46 2847.45 2847.44 0.00 94 119 0 71 FTFSTAHPLTSGNQQIVGIDYPDLVK
2924.53 2923.52 2923.54 -0.02 422 449 1 53 GVYTVPFDPGALPPGQVSQAAVDELLKR
2924.53 2923.52 2923.54 -0.02 422 449 1 53 GVYTVPFDPGALPPGQVSQAAVDELLKR
2924.53 2923.52 2923.54 -0.02 422 449 1 108 GVYTVPFDPGALPPGQVSQAAVDELLKR
3903.91 3902.90 3902.82 0.08 299 336 0 ---- AEVSDVANAVLDYTDAVMLSAESAAGSYPVEAVQAMAR 2 Oxidation (M)

No match to: 856.23, 856.53, 859.22, 862.62, 870.55, 882.27, 970.58, 995.63, 1358.70, 1382.67, 1411.86, 1418.73, 1424.74, 1425.25, 1462.78, 1463.28, 1473.78, 1489.80, 1505.78, 1647.86, 1765.04, 1809.97, 1825.90, 1841.96, 1842.92, 1867.99, 2210.04, 2241.09, 2779.97, 2788.43, 2992.66, 3842.99, 3907.81, 3919.83


Accession Mass Score Description (genome sequence location)
5. 16853.00116680 48838 884 4887249..4888607
Observed Mr(expt) Mr(calc) Delta Start End Miss Ions Peptide
878.58 877.57 877.56 0.01 237 243 1 ---- IILHARR
935.48 934.47 934.45 0.01 210 218 0 ---- ASDAVMVAR Oxidation (M)
941.62 940.62 940.58 0.03 21 28 1 ---- LIREIAAR
962.58 961.57 961.56 0.01 445 453 0 ---- ILHVGDPLV
962.58 961.57 961.56 0.01 445 453 0 42 ILHVGDPLV
1057.43 1056.42 1056.42 0.01 168 176 0 ---- DAADMEYAR Oxidation (M)
1057.43 1056.42 1056.42 0.01 168 176 0 5 DAADMEYAR Oxidation (M)
1114.62 1113.61 1113.60 0.01 134 145 0 ---- GGGLTAPALTEK
1257.73 1256.72 1256.71 0.01 32 43 0 ---- FVALLGDLQGPK
1257.73 1256.72 1256.71 0.01 32 43 0 96 FVALLGDLQGPK
1296.69 1295.68 1295.67 0.01 305 316 1 ---- ICVGAEKHPTGK Carbamidomethyl (C)
1360.72 1359.71 1359.69 0.02 368 379 0 ---- SSVPIYAFSPHR
1360.72 1359.71 1359.69 0.02 368 379 0 59 SSVPIYAFSPHR
1381.66 1380.66 1380.64 0.01 5 16 0 ---- LNFSHGTPDEHK
1453.66 1452.65 1452.63 0.02 431 444 0 ---- GDSYHTIGGTNGMK Oxidation (M)
1457.81 1456.81 1456.79 0.01 418 430 0 ---- GLVEQGDWVILTK
1533.70 1532.69 1532.68 0.02 88 101 0 ---- DCGVGDELLLDDGR Carbamidomethyl (C)
1598.85 1597.84 1597.83 0.01 195 209 0 ---- AEAVANDEVLDALIR
1598.85 1597.84 1597.83 0.01 195 209 0 36 AEAVANDEVLDALIR
1613.92 1612.91 - 1612.89 0.02 417 430 1 ---- RGLVEQGDWVILTK
1629.90 1628.89 1628.88 0.02 366 379 1 ---- IRSSVPIYAFSPHR
1629.90 1628.89 1628.88 0.02 366 379 1 16 IRSSVPIYAFSPHR
1698.91 1697.90 1697.88 0.02 219 235 0 ---- GDLGVEIGDAELVGVQK
1698.91 1697.90 1697.88 0.02 219 235 0 35 GDLGVEIGDAELVGVQK
1826.91 1825.90 1825.89 0.01 152 167 0 ---- LAAEMDLDYLAVSFPR Oxidation (M)
1826.91 1825.90 1825.89 0.01 152 167 0 79 LAAEMDLDYLAVSFPR Oxidation (M)
1835.98 1834.98 1834.99 -0.01 349 365 0 ---- AIIALTESGYTPLIMSR
1852.00 1850.99 1850.98 0.01 349 365 0 ---- AIIALTESGYTPLIMSR Oxidation (M)
1852.00 1850.99 1850.98 0.01 349 365 0 18 AIIALTESGYTPLIMSR Oxidation (M)
1855.00 1853.99 1853.98 0.01 219 236 1 ---- GDLGVEIGDAELVGVQKR
1997.08 1996.07 1996.06 0.01 192 209 1 ---- IERAEAVANDEVLDALIR
1997.08 1996.07 1996.06 0.01 192 209 1 10 IERAEAVANDEVLDALIR
2195.05 2194.04 2194.02 0.02 329 348 0 ---- CDESIALAAMYTANHFPGVK Carbamidomethyl (C)
2228.05 2227.04 2227.04 0.00 247 266 0 ---- AVIVATQMMESMISSPMPTR 3 Oxidation (M)
2244.04 2243.03 2243.03 0.00 247 266 0 ---- AVIVATQMMESMISSPMPTR 4 Oxidation (M)
2528.26 2527.25 2527.25 0.00 106 128 0 ---- VDTQTAHELHCTVLIGGPLSDHK Carbamidomethyl (C)
2528.26 2527.25 2527.25 0.00 106 128 0 45 VDTQTAHELHCTVLIGGPLSDHK Carbamidomethyl (C)
2768.45 2767.44 2767.44 -0.00 390 416 0 ---- GVYTVPFDPGALPPGQVSQAAVDELLK
2848.46 2847.45 2847.44 0.00 62 87 0 ---- FTFSTAHPLTSGNQQIVGIDYPDLVK
2848.46 2847.45 2847.44 0.00 62 87 0 71 FTFSTAHPLTSGNQQIVGIDYPDLVK
2924.53 2923.52 2923.54 -0.02 390 417 1 53 GVYTVPFDPGALPPGQVSQAAVDELLKR
2924.53 2923.52 2923.54 -0.02 390 417 1 53 GVYTVPFDPGALPPGQVSQAAVDELLKR
2924.53 2923.52 2923.54 -0.02 390 417 1 108 GVYTVPFDPGALPPGQVSQAAVDELLKR
3903.91 3902.90 3902.82 0.08 267 304 0 ---- AEVSDVANAVLDYTDAVMLSAESAAGSYPVEAVQAMAR 2 Oxidation (M)

No match to: 856.23, 856.53, 859.22, 862.62, 870.55, 882.27, 970.58, 995.63, 1358.70, 1382.67, 1411.86, 1418.73, 1424.74, 1425.25, 1462.78, 1463.28, 1473.78, 1489.80, 1505.78, 1647.86, 1765.04, 1809.97, 1825.90, 1841.96, 1842.92, 1867.99, 2210.04, 2241.09, 2762.52, 2762.52, 2779.97, 2788.43, 2992.66, 3842.99, 3907.81, 3919.83



Search Parameters

Type of search MS/MS Ion Search
Enzyme Trypsin
Variable modifications Carbamidomethyl (C),Oxidation (M),Propionamide (C)
Mass values MONOISOTOPIC
Protein Mass Unrestricted
Peptide Mass Tolerance ± 50 ppm
Fragment Mass Tolerance ± 0.3 Da
Max Missed Cleavages 1
Instrument type MALDI-TOF-TOF
Query MaldiWellID SpectrumID
11 (962.58,1+) 58508 69849
15 (1057.43,1+) 58508 69845
18 (1257.73,1+) 58508 69837
22 (1360.72,1+) 58508 69838
38 (1598.85,1+) 58508 69846
41 (1629.90,1+) 58508 69844
44 (1698.91,1+) 58508 69850
49 (1826.91,1+) 58508 69839
54 (1852.00,1+) 58508 69847
58 (1997.08,1+) 58508 69851
65 (2528.26,1+) 58508 69843
67 (2762.52,1+) 58508 69841
72 (2848.46,1+) 58508 69842
73 (2924.53,1+) 58508 69848
75 (2924.53,1+) 58508 69840